PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P01580_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 92aa    MW: 10237.8 Da    PI: 7.5246
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P01580_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.51e-0720591554
                           HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                    HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                           +iN+ +++L+ +lP+a  + + ++s a +L++++ Y++sL
  GSMUA_Achr3P01580_001 20 QINDLMAKLQAVLPEARLGINHRVSAARVLQETCSYLRSL 59
                           8**************889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.737559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.9E-81974IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.7E-91977IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.1E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSGRRSRSRQ SMSPSITDEQ INDLMAKLQA VLPEARLGIN HRVSAARVLQ ETCSYLRSLH  60
REVDDLSERL SELLAMADIS GAEAAIIRSL LM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390918.13e-59PREDICTED: transcription factor ILI6-like
SwissprotA2Z7304e-37ILI7_ORYSI; Transcription factor ILI7
SwissprotQ338G64e-37ILI7_ORYSJ; Transcription factor ILI7
TrEMBLM0SAX63e-59M0SAX6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P01580_0011e-58(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.18e-30bHLH family protein